Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (24 species) not a true protein |
Species Vicugna pacos [TaxId:30538] [189756] (82 PDB entries) |
Domain d7kn7b_: 7kn7 B: [399343] Other proteins in same PDB: d7kn7a_, d7kn7l2 automated match to d1bzqk_ complexed with nag |
PDB Entry: 7kn7 (more details), 2.73 Å
SCOPe Domain Sequences for d7kn7b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7kn7b_ b.1.1.1 (B:) automated matches {Vicugna pacos [TaxId: 30538]} vqlvesggglvqpggslrlscaasgftldyyaigwfrqapgkeregvscisssgdsthyv dsvkgrftisrdnakntvylqmnslkpedtavyycaaqsgsyywcgsdwheydyrgqgtq vtvss
Timeline for d7kn7b_:
View in 3D Domains from other chains: (mouse over for more information) d7kn7a_, d7kn7h_, d7kn7l1, d7kn7l2 |