Lineage for d4gpd42 (4gpd 4:148-311)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2203126Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 2203127Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 2203128Family d.81.1.1: GAPDH-like [55348] (6 proteins)
    has many additional secondary structures
  6. 2203219Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (20 species)
  7. 2203223Species American lobster (Homarus americanus) [TaxId:6706] [55358] (2 PDB entries)
  8. 2203229Domain d4gpd42: 4gpd 4:148-311 [39934]
    Other proteins in same PDB: d4gpd11, d4gpd21, d4gpd31, d4gpd41

Details for d4gpd42

PDB Entry: 4gpd (more details), 2.8 Å

PDB Description: the structure of lobster apo-d-glyceraldehyde-3-phosphate dehydrogenase at 3.0 angstroms resolution
PDB Compounds: (4:) apo-d-glyceraldehyde-3-phosphate dehydrogenase

SCOPe Domain Sequences for d4gpd42:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gpd42 d.81.1.1 (4:148-311) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {American lobster (Homarus americanus) [TaxId: 6706]}
cttnclapvakvlhenfeiveglmttvhavtatqktvdgpsakdwrggrgaaqniipsst
gaakavgkvipeldgkltgmafrvptpdvsvvdltvrlgkecsyddikaamktasegplq
gflgyteddvvssdfigdnrssifdakagiqlsktfvkvvswyd

SCOPe Domain Coordinates for d4gpd42:

Click to download the PDB-style file with coordinates for d4gpd42.
(The format of our PDB-style files is described here.)

Timeline for d4gpd42: