Lineage for d4gpd42 (4gpd 4:148-311)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 33775Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
  4. 33776Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
  5. 33777Family d.81.1.1: GAPDH-like [55348] (2 proteins)
  6. 33783Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (11 species)
  7. 33838Species Lobster (Homarus americanus) [55358] (2 PDB entries)
  8. 33842Domain d4gpd42: 4gpd 4:148-311 [39934]
    Other proteins in same PDB: d4gpd11, d4gpd21, d4gpd31, d4gpd41

Details for d4gpd42

PDB Entry: 4gpd (more details), 2.8 Å

PDB Description: the structure of lobster apo-d-glyceraldehyde-3-phosphate dehydrogenase at 3.0 angstroms resolution
PDB Compounds: (4:)

SCOP Domain Sequences for d4gpd42:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gpd42 d.81.1.1 (4:148-311) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Lobster (Homarus americanus)}
cttnclapvakvlhenfeiveglmttvhavtatqktvdgpsakdwrggrgaaqniipsst
gaakavgkvipeldgkltgmafrvptpdvsvvdltvrlgkecsyddikaamktasegplq
gflgyteddvvssdfigdnrssifdakagiqlsktfvkvvswyd

SCOP Domain Coordinates for d4gpd42:

Click to download the PDB-style file with coordinates for d4gpd42.
(The format of our PDB-style files is described here.)

Timeline for d4gpd42: