Lineage for d4gpd32 (4gpd 3:148-311)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 331066Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 331067Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 331068Family d.81.1.1: GAPDH-like [55348] (3 proteins)
    has many additional secondary structures
  6. 331086Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (14 species)
  7. 331180Species Lobster (Homarus americanus) [55358] (2 PDB entries)
  8. 331183Domain d4gpd32: 4gpd 3:148-311 [39933]
    Other proteins in same PDB: d4gpd11, d4gpd21, d4gpd31, d4gpd41

Details for d4gpd32

PDB Entry: 4gpd (more details), 2.8 Å

PDB Description: the structure of lobster apo-d-glyceraldehyde-3-phosphate dehydrogenase at 3.0 angstroms resolution

SCOP Domain Sequences for d4gpd32:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gpd32 d.81.1.1 (3:148-311) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Lobster (Homarus americanus)}
cttnclapvakvlhenfeiveglmttvhavtatqktvdgpsakdwrggrgaaqniipsst
gaakavgkvipeldgkltgmafrvptpdvsvvdltvrlgkecsyddikaamktasegplq
gflgyteddvvssdfigdnrssifdakagiqlsktfvkvvswyd

SCOP Domain Coordinates for d4gpd32:

Click to download the PDB-style file with coordinates for d4gpd32.
(The format of our PDB-style files is described here.)

Timeline for d4gpd32: