Lineage for d4gpd12 (4gpd 1:148-311)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 81620Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
  4. 81621Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
  5. 81622Family d.81.1.1: GAPDH-like [55348] (2 proteins)
  6. 81628Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (11 species)
  7. 81686Species Lobster (Homarus americanus) [55358] (2 PDB entries)
  8. 81687Domain d4gpd12: 4gpd 1:148-311 [39931]
    Other proteins in same PDB: d4gpd11, d4gpd21, d4gpd31, d4gpd41

Details for d4gpd12

PDB Entry: 4gpd (more details), 2.8 Å

PDB Description: the structure of lobster apo-d-glyceraldehyde-3-phosphate dehydrogenase at 3.0 angstroms resolution

SCOP Domain Sequences for d4gpd12:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gpd12 d.81.1.1 (1:148-311) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Lobster (Homarus americanus)}
cttnclapvakvlhenfeiveglmttvhavtatqktvdgpsakdwrggrgaaqniipsst
gaakavgkvipeldgkltgmafrvptpdvsvvdltvrlgkecsyddikaamktasegplq
gflgyteddvvssdfigdnrssifdakagiqlsktfvkvvswyd

SCOP Domain Coordinates for d4gpd12:

Click to download the PDB-style file with coordinates for d4gpd12.
(The format of our PDB-style files is described here.)

Timeline for d4gpd12: