Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.318: SARS receptor-binding domain-like [143586] (1 superfamily) core: 3 layers, a/b/a; antiparallel beta-sheet of 5 strands, order 13542 |
Superfamily d.318.1: SARS receptor-binding domain-like [143587] (1 family) automatically mapped to Pfam PF09408 |
Family d.318.1.1: SARS receptor-binding domain-like [143588] (2 proteins) part of PfamB PB000266 |
Protein Spike protein S1 [143589] (5 species) |
Species Severe acute respiratory syndrome coronavirus 2 [TaxId:2697049] [382292] (118 PDB entries) |
Domain d7kn7a_: 7kn7 A: [399293] Other proteins in same PDB: d7kn7b_, d7kn7h_, d7kn7l1, d7kn7l2 automated match to d2dd8s1 complexed with nag |
PDB Entry: 7kn7 (more details), 2.73 Å
SCOPe Domain Sequences for d7kn7a_:
Sequence, based on SEQRES records: (download)
>d7kn7a_ d.318.1.1 (A:) Spike protein S1 {Severe acute respiratory syndrome coronavirus 2 [TaxId: 2697049]} nlcpfgevfnatrfasvyawnrkrisncvadysvlynsasfstfkcygvsptklndlcft nvyadsfvirgdevrqiapgqtgkiadynyklpddftgcviawnsnnldskvggnynyly rlfrksnlkpferdisteiyqagstpcngvegfncyfplqsygfqptngvgyqpyrvvvl sfellhapatvcgp
>d7kn7a_ d.318.1.1 (A:) Spike protein S1 {Severe acute respiratory syndrome coronavirus 2 [TaxId: 2697049]} nlcpfgevfnatrfasvyawnrkrisncvadysvlynsasfstfkcygvsptklndlcft nvyadsfvirgdevrqiapgqtgkiadynyklpddftgcviawnsnnldskvggnynyly rlfrksnlkpferdisteiyqagstpcngvegfncyfplqsygfqptngvgyqpyrvvvl sfpatvcgp
Timeline for d7kn7a_:
View in 3D Domains from other chains: (mouse over for more information) d7kn7b_, d7kn7h_, d7kn7l1, d7kn7l2 |