Lineage for d7khya_ (7khy A:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3012718Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 3012719Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 3014129Family e.3.1.0: automated matches [191512] (1 protein)
    not a true family
  6. 3014130Protein automated matches [190857] (70 species)
    not a true protein
  7. 3014381Species Enterobacter cloacae [TaxId:550] [271105] (8 PDB entries)
  8. 3014382Domain d7khya_: 7khy A: [399292]
    automated match to d5odzb_
    complexed with cl, mer, mpd, zn

Details for d7khya_

PDB Entry: 7khy (more details), 1.84 Å

PDB Description: crystal structure of oxa-163 k73a in complex with meropenem
PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d7khya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7khya_ e.3.1.0 (A:) automated matches {Enterobacter cloacae [TaxId: 550]}
wqenkswnahftehksqgvvvlwnenkqqgftnnlkranqaflpastfaipnslialdlg
vvkdehqvfkwdgqtrdiatwnrdhnlitamkysvvpvyqefarqigearmskmlhafdy
gnedisgnvdsfwldggirisateqisflrklyhnklhvsersqrivkqamlteangdyi
iraktgydtkigwwvgwvelddnvwffamnmdmptsdglglrqaitkevlkqekiip

SCOPe Domain Coordinates for d7khya_:

Click to download the PDB-style file with coordinates for d7khya_.
(The format of our PDB-style files is described here.)

Timeline for d7khya_: