Lineage for d1gyqb2 (1gyq B:166-334)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 606541Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 606542Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 606543Family d.81.1.1: GAPDH-like [55348] (4 proteins)
    has many additional secondary structures
  6. 606585Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (16 species)
  7. 606655Species Leishmania mexicana [TaxId:5665] [55357] (5 PDB entries)
  8. 606677Domain d1gyqb2: 1gyq B:166-334 [39928]
    Other proteins in same PDB: d1gyqa1, d1gyqb1, d1gyqc1, d1gyqd1

Details for d1gyqb2

PDB Entry: 1gyq (more details), 3.4 Å

PDB Description: crystal structure of glycosomal glyceraldehyde from leishmania mexicana in complex with n6-benzyl-nad

SCOP Domain Sequences for d1gyqb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gyqb2 d.81.1.1 (B:166-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Leishmania mexicana}
cttnclapivhvltkenfgietglmttihsytatqktvdgvslkdwrggraaavniipst
tgaakavgmvipstkgkltgmsfrvptpdvsvvdltfratrdtsiqeidkaikkaaqtym
kgilgftdeelvsadfindnrssvydskatlqnnlpgekrffkvvswyd

SCOP Domain Coordinates for d1gyqb2:

Click to download the PDB-style file with coordinates for d1gyqb2.
(The format of our PDB-style files is described here.)

Timeline for d1gyqb2: