SCOPe 2.08: Domain d7khqb1: 7khq B:25-265

Lineage for d7khqb1 (7khq B:25-265)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.0: automated matches [191512] (1 protein)
   not a true family

6. Protein automated matches [190857] (70 species)
   not a true protein

7. Species Klebsiella pneumoniae [TaxId:573] [225260] (114 PDB entries)

8. Domain d7khqb1: 7khq B:25-265 [399278]
   Other proteins in same PDB: d7khqa2, d7khqb2
   automated match to d5dtka_
   complexed with cl, mer, zn

Details for d7khqb1

PDB Entry: 7khq, 2 Å

PDB Description: crystal structure of oxa-48 k73a in complex with meropenem

PDB Compounds: (B:) Beta-lactamase

SCOPe Domain Sequences for d7khqb1:

Sequence; same for both SEQRES and ATOM records:

>d7khqb1 e.3.1.0 (B:25-265) automated matches {Klebsiella pneumoniae [TaxId: 573]}
wqenkswnahftehksqgvvvlwnenkqqgftnnlkranqaflpastfaipnslialdlg
vvkdehqvfkwdgqtrdiatwnrdhnlitamkysvvpvyqefarqigearmskmlhafdy
gnedisgnvdsfwldggirisateqisflrklyhnklhvsersqrivkqamlteangdyi
iraktgystriepkigwwvgwvelddnvwffamnmdmptsdglglrqaitkevlkqekii
p

Timeline for d7khqb1:

• d7khqb1 first appeared in SCOPe 2.07