SCOPe 2.08: Domain d7kc7b1: 7kc7 B:1-114

Lineage for d7kc7b1 (7kc7 B:1-114)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
   3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
   possible rudiment form of Rossmann-fold domain

4. Superfamily c.30.1: PreATP-grasp domain [52440] (10 families)
   precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function

5. Family c.30.1.0: automated matches [227183] (1 protein)
   not a true family

6. Protein automated matches [226903] (40 species)
   not a true protein

7. Species Hydrogenobacter thermophilus [TaxId:940] [399165] (3 PDB entries)

8. Domain d7kc7b1: 7kc7 B:1-114 [399269]
   Other proteins in same PDB: d7kc7a2, d7kc7a3, d7kc7b2, d7kc7b3
   automated match to d1ulza2
   complexed with adp, po4

Details for d7kc7b1

PDB Entry: 7kc7, 2.2 Å

PDB Description: biotin carboxylase domain of thermophilic 2-oxoglutarate carboxylase bound to adp without magnesium with disordered phosphate tail

PDB Compounds: (B:) 2-oxoglutarate carboxylase small subunit

SCOPe Domain Sequences for d7kc7b1:

Sequence; same for both SEQRES and ATOM records:

>d7kc7b1 c.30.1.0 (B:1-114) automated matches {Hydrogenobacter thermophilus [TaxId: 940]}
mfkkvlvanrgeiacrvirackelgiqtvaiyneiestarhvkmadeaymigvnpldtyl
naerivdlalevgaeaihpgygflaenehfarlceekgitfigphwkvielmgd

Timeline for d7kc7b1:

• d7kc7b1 first appeared in SCOPe 2.07