Lineage for d1a7kc2 (1a7k C:166-334)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1421944Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 1421945Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 1421946Family d.81.1.1: GAPDH-like [55348] (6 proteins)
    has many additional secondary structures
  6. 1422023Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (19 species)
  7. 1422242Species Trypanosome (Leishmania mexicana) [TaxId:5665] [55357] (5 PDB entries)
  8. 1422255Domain d1a7kc2: 1a7k C:166-334 [39925]
    Other proteins in same PDB: d1a7ka1, d1a7kb1, d1a7kc1, d1a7kd1
    complexed with nad, po4

Details for d1a7kc2

PDB Entry: 1a7k (more details), 2.8 Å

PDB Description: glycosomal glyceraldehyde-3-phosphate dehydrogenase in a monoclinic crystal form
PDB Compounds: (C:) glyceraldehyde-3-phosphate dehydrogenase

SCOPe Domain Sequences for d1a7kc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a7kc2 d.81.1.1 (C:166-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosome (Leishmania mexicana) [TaxId: 5665]}
cttnclapivhvltkenfgietglmttihsytatqktvdgvslkdwrggraaavniipst
tgaakavgmvipstkgkltgmsfrvptpdvsvvdltfratrdtsiqeidkaikkaaqtym
kgilgftdeelvsadfindnrssvydskatlqnnlpgekrffkvvswyd

SCOPe Domain Coordinates for d1a7kc2:

Click to download the PDB-style file with coordinates for d1a7kc2.
(The format of our PDB-style files is described here.)

Timeline for d1a7kc2: