SCOPe 2.07: Domain d7jz2f2: 7jz2 F:107-238

Lineage for d7jz2f2 (7jz2 F:107-238)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families)
   contains two Fe4-S4 clusters

5. Family a.1.2.1: Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain [46549] (3 proteins)

6. Protein Succinate dehydogenase [81669] (3 species)

7. Species Escherichia coli [TaxId:562] [81670] (6 PDB entries)

8. Domain d7jz2f2: 7jz2 F:107-238 [399228]
   Other proteins in same PDB: d7jz2a1, d7jz2a2, d7jz2b1, d7jz2c_, d7jz2d_, d7jz2e1, d7jz2e2, d7jz2f1, d7jz2g_, d7jz2h_, d7jz2i1, d7jz2i2, d7jz2j1, d7jz2k_, d7jz2l_
   automated match to d1nekb1
   complexed with 3pe, f3s, fad, fes, hem, na, sf4, uq2

Details for d7jz2f2

PDB Entry: 7jz2, 2.5 Å

PDB Description: succinate: quinone oxidoreductase sqr from e.coli k12

PDB Compounds: (F:) succinate dehydrogenase iron-sulfur subunit

SCOPe Domain Sequences for d7jz2f2:

Sequence; same for both SEQRES and ATOM records:

>d7jz2f2 a.1.2.1 (F:107-238) Succinate dehydogenase {Escherichia coli [TaxId: 562]}
mgqfyaqyekikpyllnngqnpparehlqmpeqrekldglyecilcaccstscpsfwwnp
dkfigpagllaayrflidsrdtetdsrldglsdafsvfrchsimncvsvcpkglnptrai
ghiksmllqrna

Timeline for d7jz2f2:

• d7jz2f2 is new in SCOPe 2.07-stable
  
• d7jz2f2 appears in the current release, SCOPe 2.08