Lineage for d1gypc2 (1gyp C:166-334)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 727888Fold d.81: FwdE/GAPDH domain-like [55346] (3 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 727889Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 727890Family d.81.1.1: GAPDH-like [55348] (6 proteins)
    has many additional secondary structures
  6. 727944Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (19 species)
  7. 728032Species Leishmania mexicana [TaxId:5665] [55357] (5 PDB entries)
  8. 728047Domain d1gypc2: 1gyp C:166-334 [39921]
    Other proteins in same PDB: d1gypa1, d1gypb1, d1gypc1, d1gypd1

Details for d1gypc2

PDB Entry: 1gyp (more details), 2.8 Å

PDB Description: crystal structure of glycosomal glyceraldehyde-3-phosphate dehydrogenase from leishmania mexicana: implications for structure-based drug design and a new position for the inorganic phosphate binding site
PDB Compounds: (C:) glyceraldehyde-3-phosphate dehydrogenase

SCOP Domain Sequences for d1gypc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gypc2 d.81.1.1 (C:166-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Leishmania mexicana [TaxId: 5665]}
cttnclapivhvltkenfgietglmttihsytatqktvdgvslkdwrggraaavniipst
tgaakavgmvipstkgkltgmsfrvptpdvsvvdltfratrdtsiqeidkaikkaaqtym
kgilgftdeelvsadfindnrssvydskatlqnnlpgekrffkvvswyd

SCOP Domain Coordinates for d1gypc2:

Click to download the PDB-style file with coordinates for d1gypc2.
(The format of our PDB-style files is described here.)

Timeline for d1gypc2: