Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) |
Family e.3.1.0: automated matches [191512] (1 protein) not a true family |
Protein automated matches [190857] (70 species) not a true protein |
Species Enterobacter cloacae [TaxId:550] [271105] (8 PDB entries) |
Domain d7khza_: 7khz A: [399208] automated match to d5odzb_ complexed with cl, im2, zn |
PDB Entry: 7khz (more details), 2.04 Å
SCOPe Domain Sequences for d7khza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7khza_ e.3.1.0 (A:) automated matches {Enterobacter cloacae [TaxId: 550]} wqenkswnahftehksqgvvvlwnenkqqgftnnlkranqaflpastfaipnslialdlg vvkdehqvfkwdgqtrdiatwnrdhnlitamkysvvpvyqefarqigearmskmlhafdy gnedisgnvdsfwldggirisateqisflrklyhnklhvsersqrivkqamlteangdyi iraktgydtkigwwvgwvelddnvwffamnmdmptsdglglrqaitkevlkqekiip
Timeline for d7khza_: