SCOPe 2.05: Domain d1gypb2: 1gyp B:166-334

Lineage for d1gypb2 (1gyp B:166-334)

Root: SCOPe 2.05
Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families)
N-terminal domain is the classic Rossmann-fold
Family d.81.1.1: GAPDH-like [55348] (6 proteins)
has many additional secondary structures
Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (19 species)
Species Trypanosome (Leishmania mexicana) [TaxId:5665] [55357] (5 PDB entries)
Domain d1gypb2: 1gyp B:166-334 [39920]
Other proteins in same PDB: d1gypa1, d1gypb1, d1gypc1, d1gypd1
complexed with nad, po4

Details for d1gypb2

PDB Entry: 1gyp (more details), 2.8 Å

PDB Description: crystal structure of glycosomal glyceraldehyde-3-phosphate dehydrogenase from leishmania mexicana: implications for structure-based drug design and a new position for the inorganic phosphate binding site

PDB Compounds: (B:) glyceraldehyde-3-phosphate dehydrogenase

SCOPe Domain Sequences for d1gypb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gypb2 d.81.1.1 (B:166-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosome (Leishmania mexicana) [TaxId: 5665]}
cttnclapivhvltkenfgietglmttihsytatqktvdgvslkdwrggraaavniipst
tgaakavgmvipstkgkltgmsfrvptpdvsvvdltfratrdtsiqeidkaikkaaqtym
kgilgftdeelvsadfindnrssvydskatlqnnlpgekrffkvvswyd

SCOPe Domain Coordinates for d1gypb2:

Click to download the PDB-style file with coordinates for d1gypb2.
(The format of our PDB-style files is described here.)

Timeline for d1gypb2: