SCOPe 2.08: Domain d7kbzd1: 7kbz D:14-134

Lineage for d7kbzd1 (7kbz D:14-134)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)

6. Protein automated matches [190191] (2 species)
   not a true protein

7. Species Streptomyces avidinii [TaxId:1895] [189343] (100 PDB entries)

8. Domain d7kbzd1: 7kbz D:14-134 [399196]
   Other proteins in same PDB: d7kbza2, d7kbzb2, d7kbzc2, d7kbzd2
   automated match to d2bc3b_
   complexed with cyn, km3

Details for d7kbzd1

PDB Entry: 7kbz, 1.9 Å

PDB Description: artificial metalloproteins with dinuclear iron centers

PDB Compounds: (D:) streptavidin

SCOPe Domain Sequences for d7kbzd1:

Sequence; same for both SEQRES and ATOM records:

>d7kbzd1 b.61.1.1 (D:14-134) automated matches {Streptomyces avidinii [TaxId: 1895]}
eagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtal
gwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawastyvghdtftkv
k

Timeline for d7kbzd1:

• d7kbzd1 first appeared in SCOPe 2.07