Lineage for d7kcta3 (7kct A:329-451)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2426781Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 2426884Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families) (S)
  5. 2427009Family b.84.2.0: automated matches [254217] (1 protein)
    not a true family
  6. 2427010Protein automated matches [254496] (16 species)
    not a true protein
  7. 2427053Species Hydrogenobacter thermophilus [TaxId:940] [399169] (3 PDB entries)
  8. 2427054Domain d7kcta3: 7kct A:329-451 [399180]
    Other proteins in same PDB: d7kcta1, d7kcta2, d7kcta4, d7kctb1, d7kctb2, d7kctb4
    automated match to d1ulza1
    complexed with adp, bct, mg

Details for d7kcta3

PDB Entry: 7kct (more details), 2.02 Å

PDB Description: crystal structure of the hydrogenobacter thermophilus 2-oxoglutarate carboxylase (ogc) biotin carboxylase (bc) domain dimer in complex with adenosine 5'-diphosphate magnesium salt (mgadp), adenosine 5'- diphosphate (adp, and bicarbonate anion (hydrogen carbonate/hco3-)
PDB Compounds: (A:) 2-oxoglutarate carboxylase small subunit

SCOPe Domain Sequences for d7kcta3:

Sequence; same for both SEQRES and ATOM records: (download)

>d7kcta3 b.84.2.0 (A:329-451) automated matches {Hydrogenobacter thermophilus [TaxId: 940]}
fngysiecrinaedpkkgfapsigtieryyvpggfgirvehasskgyeitpyydsliakl
ivwaplwevavdrmrsaletyeisgvkttipllinimkdkdfrdgkfttryleehphvfd
yae

SCOPe Domain Coordinates for d7kcta3:

Click to download the PDB-style file with coordinates for d7kcta3.
(The format of our PDB-style files is described here.)

Timeline for d7kcta3: