Lineage for d7kcta2 (7kct A:115-328)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2585054Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2585055Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2585592Family d.142.1.0: automated matches [227184] (1 protein)
    not a true family
  6. 2585593Protein automated matches [226904] (38 species)
    not a true protein
  7. 2585691Species Hydrogenobacter thermophilus [TaxId:940] [399167] (3 PDB entries)
  8. 2585692Domain d7kcta2: 7kct A:115-328 [399179]
    Other proteins in same PDB: d7kcta1, d7kcta3, d7kcta4, d7kctb1, d7kctb3, d7kctb4
    automated match to d1ulza3
    complexed with adp, bct, mg

Details for d7kcta2

PDB Entry: 7kct (more details), 2.02 Å

PDB Description: crystal structure of the hydrogenobacter thermophilus 2-oxoglutarate carboxylase (ogc) biotin carboxylase (bc) domain dimer in complex with adenosine 5'-diphosphate magnesium salt (mgadp), adenosine 5'- diphosphate (adp, and bicarbonate anion (hydrogen carbonate/hco3-)
PDB Compounds: (A:) 2-oxoglutarate carboxylase small subunit

SCOPe Domain Sequences for d7kcta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7kcta2 d.142.1.0 (A:115-328) automated matches {Hydrogenobacter thermophilus [TaxId: 940]}
karskevmkragvptvpgsdgilkdveeakriakeigypvllkasaggggrgiricrnee
elvrnyenayneavkafgrgdlllekyienpkhiefqvlgdkygnvihlgerdcsiqrrn
qklveiapsllltpeqreyygslvvkaakeigyysagtmefiadekgnlyfiemntriqv
ehpvtemitgvdivkwqiriaagerlrysqedir

SCOPe Domain Coordinates for d7kcta2:

Click to download the PDB-style file with coordinates for d7kcta2.
(The format of our PDB-style files is described here.)

Timeline for d7kcta2: