Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) |
Family d.142.1.0: automated matches [227184] (1 protein) not a true family |
Protein automated matches [226904] (38 species) not a true protein |
Species Hydrogenobacter thermophilus [TaxId:940] [399167] (3 PDB entries) |
Domain d7kcta2: 7kct A:115-328 [399179] Other proteins in same PDB: d7kcta1, d7kcta3, d7kcta4, d7kctb1, d7kctb3, d7kctb4 automated match to d1ulza3 complexed with adp, bct, mg |
PDB Entry: 7kct (more details), 2.02 Å
SCOPe Domain Sequences for d7kcta2:
Sequence; same for both SEQRES and ATOM records: (download)
>d7kcta2 d.142.1.0 (A:115-328) automated matches {Hydrogenobacter thermophilus [TaxId: 940]} karskevmkragvptvpgsdgilkdveeakriakeigypvllkasaggggrgiricrnee elvrnyenayneavkafgrgdlllekyienpkhiefqvlgdkygnvihlgerdcsiqrrn qklveiapsllltpeqreyygslvvkaakeigyysagtmefiadekgnlyfiemntriqv ehpvtemitgvdivkwqiriaagerlrysqedir
Timeline for d7kcta2:
View in 3D Domains from other chains: (mouse over for more information) d7kctb1, d7kctb2, d7kctb3, d7kctb4 |