SCOPe 2.08: Domain d7kbya1: 7kby A:14-134

Lineage for d7kbya1 (7kby A:14-134)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)

6. Protein automated matches [190191] (2 species)
   not a true protein

7. Species Streptomyces avidinii [TaxId:1895] [189343] (100 PDB entries)

8. Domain d7kbya1: 7kby A:14-134 [399148]
   Other proteins in same PDB: d7kbya2
   automated match to d2bc3b_
   complexed with act, cyn, km3

Details for d7kbya1

PDB Entry: 7kby, 1.7 Å

PDB Description: artificial metalloproteins with dinuclear iron centers

PDB Compounds: (A:) streptavidin

SCOPe Domain Sequences for d7kbya1:

Sequence; same for both SEQRES and ATOM records:

>d7kbya1 b.61.1.1 (A:14-134) automated matches {Streptomyces avidinii [TaxId: 1895]}
eagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtal
gwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawastyvghdtftkv
k

Timeline for d7kbya1:

• d7kbya1 first appeared in SCOPe 2.07