| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families) ![]() contains two Fe4-S4 clusters |
| Family a.1.2.1: Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain [46549] (3 proteins) |
| Protein Succinate dehydogenase [81669] (3 species) |
| Species Escherichia coli [TaxId:562] [81670] (6 PDB entries) |
| Domain d7jz2j2: 7jz2 J:107-238 [399134] Other proteins in same PDB: d7jz2a1, d7jz2a2, d7jz2b1, d7jz2c_, d7jz2d_, d7jz2e1, d7jz2e2, d7jz2f1, d7jz2g_, d7jz2h_, d7jz2i1, d7jz2i2, d7jz2j1, d7jz2k_, d7jz2l_ automated match to d1nekb1 complexed with 3pe, f3s, fad, fes, hem, na, sf4, uq2 |
PDB Entry: 7jz2 (more details), 2.5 Å
SCOPe Domain Sequences for d7jz2j2:
Sequence; same for both SEQRES and ATOM records: (download)
>d7jz2j2 a.1.2.1 (J:107-238) Succinate dehydogenase {Escherichia coli [TaxId: 562]}
mgqfyaqyekikpyllnngqnpparehlqmpeqrekldglyecilcaccstscpsfwwnp
dkfigpagllaayrflidsrdtetdsrldglsdafsvfrchsimncvsvcpkglnptrai
ghiksmllqrna
Timeline for d7jz2j2: