Lineage for d7jz2j2 (7jz2 J:107-238)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2303053Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families) (S)
    contains two Fe4-S4 clusters
  5. 2303054Family a.1.2.1: Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain [46549] (3 proteins)
  6. 2303085Protein Succinate dehydogenase [81669] (3 species)
  7. 2303096Species Escherichia coli [TaxId:562] [81670] (6 PDB entries)
  8. 2303108Domain d7jz2j2: 7jz2 J:107-238 [399134]
    Other proteins in same PDB: d7jz2a1, d7jz2a2, d7jz2b1, d7jz2c_, d7jz2d_, d7jz2e1, d7jz2e2, d7jz2f1, d7jz2g_, d7jz2h_, d7jz2i1, d7jz2i2, d7jz2j1, d7jz2k_, d7jz2l_
    automated match to d1nekb1
    complexed with 3pe, f3s, fad, fes, hem, na, sf4, uq2

Details for d7jz2j2

PDB Entry: 7jz2 (more details), 2.5 Å

PDB Description: succinate: quinone oxidoreductase sqr from e.coli k12
PDB Compounds: (J:) succinate dehydrogenase iron-sulfur subunit

SCOPe Domain Sequences for d7jz2j2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7jz2j2 a.1.2.1 (J:107-238) Succinate dehydogenase {Escherichia coli [TaxId: 562]}
mgqfyaqyekikpyllnngqnpparehlqmpeqrekldglyecilcaccstscpsfwwnp
dkfigpagllaayrflidsrdtetdsrldglsdafsvfrchsimncvsvcpkglnptrai
ghiksmllqrna

SCOPe Domain Coordinates for d7jz2j2:

Click to download the PDB-style file with coordinates for d7jz2j2.
(The format of our PDB-style files is described here.)

Timeline for d7jz2j2: