Lineage for d1cf2q2 (1cf2 Q:139-303)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 414572Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 414573Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 414574Family d.81.1.1: GAPDH-like [55348] (3 proteins)
    has many additional secondary structures
  6. 414598Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (16 species)
  7. 414602Species Archaeon Methanothermus fervidus [TaxId:2180] [55355] (1 PDB entry)
  8. 414605Domain d1cf2q2: 1cf2 Q:139-303 [39910]
    Other proteins in same PDB: d1cf2o1, d1cf2p1, d1cf2q1, d1cf2r1

Details for d1cf2q2

PDB Entry: 1cf2 (more details), 2.1 Å

PDB Description: three-dimensional structure of d-glyceraldehyde-3-phosphate dehydrogenase from the hyperthermophilic archaeon methanothermus fervidus

SCOP Domain Sequences for d1cf2q2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cf2q2 d.81.1.1 (Q:139-303) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus}
scnttglcrtlkplhdsfgikkvravivrrgadpaqvskgpinaiipnppklpshhgpdv
ktvldinidtmavivpttlmhqhnvmveveetptvddiidvfedtprvilisaedgltst
aeimeyakelgrsrndlfeipvwresitvvdneiyymqavhqesd

SCOP Domain Coordinates for d1cf2q2:

Click to download the PDB-style file with coordinates for d1cf2q2.
(The format of our PDB-style files is described here.)

Timeline for d1cf2q2: