![]() | Class d: Alpha and beta proteins (a+b) [53931] (194 folds) |
![]() | Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily) |
![]() | Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) ![]() |
![]() | Family d.81.1.1: GAPDH-like [55348] (2 proteins) |
![]() | Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (11 species) |
![]() | Species Methanothermus fervidus [TaxId:2180] [55355] (1 PDB entry) |
![]() | Domain d1cf2q2: 1cf2 Q:139-303 [39910] Other proteins in same PDB: d1cf2o1, d1cf2p1, d1cf2q1, d1cf2r1 |
PDB Entry: 1cf2 (more details), 2.1 Å
SCOP Domain Sequences for d1cf2q2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cf2q2 d.81.1.1 (Q:139-303) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Methanothermus fervidus} scnttglcrtlkplhdsfgikkvravivrrgadpaqvskgpinaiipnppklpshhgpdv ktvldinidtmavivpttlmhqhnvmveveetptvddiidvfedtprvilisaedgltst aeimeyakelgrsrndlfeipvwresitvvdneiyymqavhqesd
Timeline for d1cf2q2: