Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies) core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1 |
Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) N-terminal domain is the classic Rossmann-fold |
Family d.81.1.1: GAPDH-like [55348] (6 proteins) has many additional secondary structures |
Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (19 species) |
Species Methanothermus fervidus [TaxId:2180] [55355] (1 PDB entry) |
Domain d1cf2o2: 1cf2 O:139-303 [39909] Other proteins in same PDB: d1cf2o1, d1cf2p1, d1cf2q1, d1cf2r1 complexed with nap, so4 |
PDB Entry: 1cf2 (more details), 2.1 Å
SCOPe Domain Sequences for d1cf2o2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cf2o2 d.81.1.1 (O:139-303) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Methanothermus fervidus [TaxId: 2180]} scnttglcrtlkplhdsfgikkvravivrrgadpaqvskgpinaiipnppklpshhgpdv ktvldinidtmavivpttlmhqhnvmveveetptvddiidvfedtprvilisaedgltst aeimeyakelgrsrndlfeipvwresitvvdneiyymqavhqesd
Timeline for d1cf2o2: