![]() | Class d: Alpha and beta proteins (a+b) [53931] (194 folds) |
![]() | Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily) |
![]() | Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) ![]() |
![]() | Family d.81.1.1: GAPDH-like [55348] (2 proteins) |
![]() | Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (11 species) |
![]() | Species Archaeon Sulfolobus solfataricus [TaxId:2287] [55354] (1 PDB entry) |
![]() | Domain d1b7gq2: 1b7g Q:139-300 [39908] Other proteins in same PDB: d1b7go1, d1b7gq1 |
PDB Entry: 1b7g (more details), 2.05 Å
SCOP Domain Sequences for d1b7gq2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b7gq2 d.81.1.1 (Q:139-300) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus} cnttallrtictvnkvskvekvrativrraadqkevkkgpinslvpdpatvpshhakdvn svirnldiatmaviapttlmhmhfinitlkdkvekkdilsvlentprivlisskydaeat aelvevardlkrdrndipevmifsdsiyvkddevmlmyavhq
Timeline for d1b7gq2: