SCOPe 2.04: Domain d1b7go2: 1b7g O:139-300

Lineage for d1b7go2 (1b7g O:139-300)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
   core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1

4. Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families)
   N-terminal domain is the classic Rossmann-fold

5. Family d.81.1.1: GAPDH-like [55348] (6 proteins)
   has many additional secondary structures

6. Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (19 species)

7. Species Sulfolobus solfataricus [TaxId:2287] [55354] (1 PDB entry)

8. Domain d1b7go2: 1b7g O:139-300 [39907]
   Other proteins in same PDB: d1b7go1, d1b7gq1
   CASP3
   complexed with so4

Details for d1b7go2

PDB Entry: 1b7g, 2.05 Å

PDB Description: glyceraldehyde 3-phosphate dehydrogenase

PDB Compounds: (O:) protein (glyceraldehyde 3-phosphate dehydrogenase)

SCOPe Domain Sequences for d1b7go2:

Sequence; same for both SEQRES and ATOM records:

>d1b7go2 d.81.1.1 (O:139-300) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Sulfolobus solfataricus [TaxId: 2287]}
cnttallrtictvnkvskvekvrativrraadqkevkkgpinslvpdpatvpshhakdvn
svirnldiatmaviapttlmhmhfinitlkdkvekkdilsvlentprivlisskydaeat
aelvevardlkrdrndipevmifsdsiyvkddevmlmyavhq

Timeline for d1b7go2:

• d1b7go2 first appeared (with stable ids) in SCOP 1.55
  
• d1b7go2 appears in SCOPe 2.03
  
• d1b7go2 appears in SCOPe 2.05
  
• d1b7go2 appears in the current release, SCOPe 2.08