| Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
| Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily) core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1 |
Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) ![]() N-terminal domain is the classic Rossmann-fold |
| Family d.81.1.1: GAPDH-like [55348] (3 proteins) has many additional secondary structures |
| Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (16 species) |
| Species Archaeon Sulfolobus solfataricus [TaxId:2287] [55354] (1 PDB entry) |
| Domain d1b7go2: 1b7g O:139-300 [39907] Other proteins in same PDB: d1b7go1, d1b7gq1 |
PDB Entry: 1b7g (more details), 2.05 Å
SCOP Domain Sequences for d1b7go2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b7go2 d.81.1.1 (O:139-300) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus}
cnttallrtictvnkvskvekvrativrraadqkevkkgpinslvpdpatvpshhakdvn
svirnldiatmaviapttlmhmhfinitlkdkvekkdilsvlentprivlisskydaeat
aelvevardlkrdrndipevmifsdsiyvkddevmlmyavhq
Timeline for d1b7go2: