SCOP 1.59: Domain d1hdgo2: 1hdg O:149-312

Lineage for d1hdgo2 (1hdg O:149-312)

1. Root: SCOP 1.59

2. Class d: Alpha and beta proteins (a+b) [53931] (208 folds)

3. Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)

4. Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families)

5. Family d.81.1.1: GAPDH-like [55348] (2 proteins)

6. Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (12 species)

7. Species Thermotoga maritima [TaxId:243274] [55353] (1 PDB entry)

8. Domain d1hdgo2: 1hdg O:149-312 [39905]
   Other proteins in same PDB: d1hdgo1, d1hdgq1

Details for d1hdgo2

PDB Entry: 1hdg, 2.5 Å

PDB Description: the crystal structure of holo-glyceraldehyde-3-phosphate dehydrogenase from the hyperthermophilic bacterium thermotoga maritima at 2.5 angstroms resolution

SCOP Domain Sequences for d1hdgo2:

Sequence; same for both SEQRES and ATOM records:

>d1hdgo2 d.81.1.1 (O:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermotoga maritima}
cttnsiapivkvlhekfgivsgmlttvhsytndqrvldlphkdlrraraaavniiptttg
aakavalvvpevkgkldgmairvptpdgsitdltvlvekettveevnavmkeategrlkg
iigyndepivssdiigttfsgifdatitnviggklvkvaswyd

Timeline for d1hdgo2:

• d1hdgo2 first appeared (with stable ids) in SCOP 1.55
  
• d1hdgo2 appears in SCOP 1.57
  
• d1hdgo2 appears in SCOP 1.61
  
• d1hdgo2 appears in the current release, SCOPe 2.08