Lineage for d1cerr2 (1cer R:149-312)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 81620Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
  4. 81621Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
  5. 81622Family d.81.1.1: GAPDH-like [55348] (2 proteins)
  6. 81628Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (11 species)
  7. 81708Species Thermus aquaticus [TaxId:271] [55352] (1 PDB entry)
  8. 81712Domain d1cerr2: 1cer R:149-312 [39904]
    Other proteins in same PDB: d1cero1, d1cerp1, d1cerq1, d1cerr1

Details for d1cerr2

PDB Entry: 1cer (more details), 2.5 Å

PDB Description: determinants of enzyme thermostability observed in the molecular structure of thermus aquaticus d-glyceraldehyde-3-phosphate dehydrogenase at 2.5 angstroms resolution

SCOP Domain Sequences for d1cerr2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cerr2 d.81.1.1 (R:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus}
cttnslapvmkvleeafgvekalmttvhsytndqrlldlphkdlrraraaainiiptttg
aakatalvlpslkgrfdgmalrvptatgsisditallkrevtaeevnaalkaaaegplkg
ilaytedeivlqdivmdphssivdakltkalgnmvkvfawyd

SCOP Domain Coordinates for d1cerr2:

Click to download the PDB-style file with coordinates for d1cerr2.
(The format of our PDB-style files is described here.)

Timeline for d1cerr2: