Lineage for d7jy5b2 (7jy5 B:107-200)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2942267Fold d.31: Cdc48 domain 2-like [54584] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2942268Superfamily d.31.1: Cdc48 domain 2-like [54585] (2 families) (S)
  5. 2942269Family d.31.1.1: Cdc48 domain 2-like [54586] (4 proteins)
  6. 2942284Protein Membrane fusion atpase p97 domain 2, P97-Nc [64254] (2 species)
  7. 2942285Species Human (Homo sapiens) [TaxId:9606] [233318] (13 PDB entries)
  8. 2942309Domain d7jy5b2: 7jy5 B:107-200 [399038]
    Other proteins in same PDB: d7jy5a1, d7jy5a3, d7jy5a4, d7jy5b1, d7jy5b3, d7jy5b4, d7jy5c1, d7jy5c3, d7jy5c4, d7jy5d1, d7jy5d3, d7jy5d4, d7jy5e1, d7jy5e3, d7jy5e4, d7jy5f1, d7jy5f3, d7jy5f4
    automated match to d3cf1a4
    complexed with ags, mg

Details for d7jy5b2

PDB Entry: 7jy5 (more details), 2.89 Å

PDB Description: structure of human p97 in complex with atpgammas and npl4/ufd1 (masked around p97)
PDB Compounds: (B:) Transitional endoplasmic reticulum ATPase

SCOPe Domain Sequences for d7jy5b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7jy5b2 d.31.1.1 (B:107-200) Membrane fusion atpase p97 domain 2, P97-Nc {Human (Homo sapiens) [TaxId: 9606]}
dvkygkrihvlpiddtvegitgnlfevylkpyfleayrpirkgdiflvrggmravefkvv
etdpspycivapdtvihcegepikredeeeslne

SCOPe Domain Coordinates for d7jy5b2:

Click to download the PDB-style file with coordinates for d7jy5b2.
(The format of our PDB-style files is described here.)

Timeline for d7jy5b2: