| Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
| Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies) core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1 |
Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) ![]() N-terminal domain is the classic Rossmann-fold |
| Family d.81.1.1: GAPDH-like [55348] (6 proteins) has many additional secondary structures |
| Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (19 species) |
| Species Thermus aquaticus [TaxId:271] [55352] (2 PDB entries) |
| Domain d1cerp2: 1cer P:149-312 [39903] Other proteins in same PDB: d1cera1, d1cerb1, d1cerc1, d1cerd1, d1cero1, d1cerp1, d1cerq1, d1cerr1 complexed with nad |
PDB Entry: 1cer (more details), 2.5 Å
SCOPe Domain Sequences for d1cerp2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cerp2 d.81.1.1 (P:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus [TaxId: 271]}
cttnslapvmkvleeafgvekalmttvhsytndqrlldlphkdlrraraaainiiptttg
aakatalvlpslkgrfdgmalrvptatgsisditallkrevtaeevnaalkaaaegplkg
ilaytedeivlqdivmdphssivdakltkalgnmvkvfawyd
Timeline for d1cerp2: