SCOP 1.63: Domain d1cerp2: 1cer P:149-312

Lineage for d1cerp2 (1cer P:149-312)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
   core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1

4. Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families)
   N-terminal domain is the classic Rossmann-fold

5. Family d.81.1.1: GAPDH-like [55348] (2 proteins)
   has many additional secondary structures

6. Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (13 species)

7. Species Thermus aquaticus [TaxId:271] [55352] (1 PDB entry)

8. Domain d1cerp2: 1cer P:149-312 [39903]
   Other proteins in same PDB: d1cero1, d1cerp1, d1cerq1, d1cerr1

Details for d1cerp2

PDB Entry: 1cer, 2.5 Å

PDB Description: determinants of enzyme thermostability observed in the molecular structure of thermus aquaticus d-glyceraldehyde-3-phosphate dehydrogenase at 2.5 angstroms resolution

SCOP Domain Sequences for d1cerp2:

Sequence; same for both SEQRES and ATOM records:

>d1cerp2 d.81.1.1 (P:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus}
cttnslapvmkvleeafgvekalmttvhsytndqrlldlphkdlrraraaainiiptttg
aakatalvlpslkgrfdgmalrvptatgsisditallkrevtaeevnaalkaaaegplkg
ilaytedeivlqdivmdphssivdakltkalgnmvkvfawyd

Timeline for d1cerp2:

• d1cerp2 first appeared (with stable ids) in SCOP 1.55
  
• d1cerp2 appears in SCOP 1.61
  
• d1cerp2 appears in SCOP 1.65
  
• d1cerp2 appears in the current release, SCOPe 2.08