Class d: Alpha and beta proteins (a+b) [53931] (194 folds) |
Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily) |
Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) |
Family d.81.1.1: GAPDH-like [55348] (2 proteins) |
Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (11 species) |
Species Thermus aquaticus [TaxId:271] [55352] (1 PDB entry) |
Domain d1cerp2: 1cer P:149-312 [39903] Other proteins in same PDB: d1cero1, d1cerp1, d1cerq1, d1cerr1 |
PDB Entry: 1cer (more details), 2.5 Å
SCOP Domain Sequences for d1cerp2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cerp2 d.81.1.1 (P:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus} cttnslapvmkvleeafgvekalmttvhsytndqrlldlphkdlrraraaainiiptttg aakatalvlpslkgrfdgmalrvptatgsisditallkrevtaeevnaalkaaaegplkg ilaytedeivlqdivmdphssivdakltkalgnmvkvfawyd
Timeline for d1cerp2: