Lineage for d1cerq2 (1cer Q:149-312)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2568239Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 2568240Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 2568241Family d.81.1.1: GAPDH-like [55348] (6 proteins)
    has many additional secondary structures
  6. 2568332Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (21 species)
  7. 2568518Species Thermus aquaticus [TaxId:271] [55352] (2 PDB entries)
  8. 2568533Domain d1cerq2: 1cer Q:149-312 [39902]
    Other proteins in same PDB: d1cera1, d1cerb1, d1cerc1, d1cerd1, d1cero1, d1cerp1, d1cerq1, d1cerr1
    complexed with nad

Details for d1cerq2

PDB Entry: 1cer (more details), 2.5 Å

PDB Description: determinants of enzyme thermostability observed in the molecular structure of thermus aquaticus d-glyceraldehyde-3-phosphate dehydrogenase at 2.5 angstroms resolution
PDB Compounds: (Q:) holo-d-glyceraldehyde-3-phosphate dehydrogenase

SCOPe Domain Sequences for d1cerq2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cerq2 d.81.1.1 (Q:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus [TaxId: 271]}
cttnslapvmkvleeafgvekalmttvhsytndqrlldlphkdlrraraaainiiptttg
aakatalvlpslkgrfdgmalrvptatgsisditallkrevtaeevnaalkaaaegplkg
ilaytedeivlqdivmdphssivdakltkalgnmvkvfawyd

SCOPe Domain Coordinates for d1cerq2:

Click to download the PDB-style file with coordinates for d1cerq2.
(The format of our PDB-style files is described here.)

Timeline for d1cerq2: