SCOP 1.69: Domain d1cerq2: 1cer Q:149-312

Lineage for d1cerq2 (1cer Q:149-312)

Root: SCOP 1.69
Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families)
N-terminal domain is the classic Rossmann-fold
Family d.81.1.1: GAPDH-like [55348] (4 proteins)
has many additional secondary structures
Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (16 species)
Species Thermus aquaticus [TaxId:271] [55352] (1 PDB entry)
Domain d1cerq2: 1cer Q:149-312 [39902]
Other proteins in same PDB: d1cero1, d1cerp1, d1cerq1, d1cerr1

Details for d1cerq2

PDB Entry: 1cer (more details), 2.5 Å

PDB Description: determinants of enzyme thermostability observed in the molecular structure of thermus aquaticus d-glyceraldehyde-3-phosphate dehydrogenase at 2.5 angstroms resolution

SCOP Domain Sequences for d1cerq2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cerq2 d.81.1.1 (Q:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus}
cttnslapvmkvleeafgvekalmttvhsytndqrlldlphkdlrraraaainiiptttg
aakatalvlpslkgrfdgmalrvptatgsisditallkrevtaeevnaalkaaaegplkg
ilaytedeivlqdivmdphssivdakltkalgnmvkvfawyd

SCOP Domain Coordinates for d1cerq2:

Click to download the PDB-style file with coordinates for d1cerq2.
(The format of our PDB-style files is described here.)

Timeline for d1cerq2: