SCOPe 2.08: Domain d7jy5e3: 7jy5 E:201-470

Lineage for d7jy5e3 (7jy5 E:201-470)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.20: Extended AAA-ATPase domain [81269] (43 proteins)
   fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain

6. Protein Membrane fusion ATPase VCP/p97 [64038] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [313486] (5 PDB entries)

8. Domain d7jy5e3: 7jy5 E:201-470 [399016]
   Other proteins in same PDB: d7jy5a1, d7jy5a2, d7jy5b1, d7jy5b2, d7jy5c1, d7jy5c2, d7jy5d1, d7jy5d2, d7jy5e1, d7jy5e2, d7jy5f1, d7jy5f2
   automated match to d3cf1a2
   complexed with ags, mg

Details for d7jy5e3

PDB Entry: 7jy5, 2.89 Å

PDB Description: structure of human p97 in complex with atpgammas and npl4/ufd1 (masked around p97)

PDB Compounds: (E:) Transitional endoplasmic reticulum ATPase

SCOPe Domain Sequences for d7jy5e3:

Sequence; same for both SEQRES and ATOM records:

>d7jy5e3 c.37.1.20 (E:201-470) Membrane fusion ATPase VCP/p97 {Human (Homo sapiens) [TaxId: 9606]}
vgyddiggcrkqlaqikemvelplrhpalfkaigvkpprgillygppgtgktliaravan
etgaffflingpeimsklagesesnlrkafeeaeknapaiifideldaiapkrekthgev
errivsqlltlmdglkqrahvivmaatnrpnsidpalrrfgrfdrevdigipdatgrlei
lqihtknmkladdvdleqvanethghvgadlaalcseaalqairkkmdlidledetidae
vmnslavtmddfrwalsqsnpsalretvve

Timeline for d7jy5e3:

• d7jy5e3 first appeared in SCOPe 2.07