SCOPe 2.07: Domain d7jmkc2: 7jmk C:131-306

Lineage for d7jmkc2 (7jmk C:131-306)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (2 families)

5. Family c.23.4.1: Succinyl-CoA synthetase domains [52211] (3 proteins)
   contain additional N-terminal strand "0", antiparallel to strand 2

6. Protein Succinyl-CoA synthetase, alpha-chain, C-terminal domain [52212] (6 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [52214] (13 PDB entries)

8. Domain d7jmkc2: 7jmk C:131-306 [399013]
   Other proteins in same PDB: d7jmka1, d7jmkb1, d7jmkb2, d7jmkc1, d7jmkd1, d7jmkd2
   automated match to d1euda2
   complexed with gdp, mg

Details for d7jmkc2

PDB Entry: 7jmk, 2.5 Å

PDB Description: gtp-specific succinyl-coa synthetase complexed with mg-gdp in space group p32

PDB Compounds: (C:) Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial

SCOPe Domain Sequences for d7jmkc2:

Sequence, based on SEQRES records:

>d7jmkc2 c.23.4.1 (C:131-306) Succinyl-CoA synthetase, alpha-chain, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
ncpgvinpgeckigimpghihkkgrigivsrsgtltyeavhqttqvglgqslcvgiggdp
fngtdftdcleiflndpategiiligeiggnaeenaaeflkqhnsgpkskpvvsfiaglt
appgrrmghagaiiaggkggakekitalqsagvvvsmspaqlgttiykefekrkml

Sequence, based on observed residues (ATOM records):

>d7jmkc2 c.23.4.1 (C:131-306) Succinyl-CoA synthetase, alpha-chain, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
ncpgvinpgeckigimpghihkkgrigivsrsgtltyeavhqttqvglgqslcvgiggdp
fngtdftdcleiflndpategiiligeiggnaeenaaeflkqhnsgpkskpvvsfiaglt
appgagaiikggakekitalqsagvvvsmspaqlgttiykefekrkml

Timeline for d7jmkc2:

• d7jmkc2 is new in SCOPe 2.07-stable
  
• d7jmkc2 appears in the current release, SCOPe 2.08