![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.8: CoA-binding domain [51900] (6 proteins) |
![]() | Protein Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain [51901] (6 species) |
![]() | Species Pig (Sus scrofa) [TaxId:9823] [51903] (13 PDB entries) |
![]() | Domain d7jmka1: 7jmk A:2-130 [399008] Other proteins in same PDB: d7jmka2, d7jmkb1, d7jmkb2, d7jmkc2, d7jmkd1, d7jmkd2 automated match to d1euda1 complexed with gdp, mg |
PDB Entry: 7jmk (more details), 2.5 Å
SCOPe Domain Sequences for d7jmka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7jmka1 c.2.1.8 (A:2-130) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Pig (Sus scrofa) [TaxId: 9823]} sytasrkhlyvdkntkvicqgftgkqgtfhsqqaleygtnlvggttpgkggkthlglpvf ntvkeakeqtgatasviyvpppfaaaaineaidaevplvvcitegipqqdmvrvkhrllr qgktrligp
Timeline for d7jmka1: