Lineage for d7juea1 (7jue A:628-761)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3001353Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 3001354Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 3002276Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 3002277Protein automated matches [190159] (21 species)
    not a true protein
  7. 3002332Species Human (Homo sapiens) [TaxId:9606] [186882] (109 PDB entries)
  8. 3002356Domain d7juea1: 7jue A:628-761 [399006]
    Other proteins in same PDB: d7juea2
    automated match to d3alta_
    complexed with ca

Details for d7juea1

PDB Entry: 7jue (more details), 1.4 Å

PDB Description: c-type carbohydrate-recognition domain 4 of the mannose receptor complexed with man-alpha1-2man
PDB Compounds: (A:) Macrophage mannose receptor 1

SCOPe Domain Sequences for d7juea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7juea1 d.169.1.0 (A:628-761) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cpedwgassrtslcfklyakgkhekktwfesrdfcralggdlasinnkeeqqtiwrlita
sgsyhklfwlgltygspsegftwsdgspvsyenwaygepnnyqnveycgelkgdptmswn
dincehlnnwicqi

SCOPe Domain Coordinates for d7juea1:

Click to download the PDB-style file with coordinates for d7juea1.
(The format of our PDB-style files is described here.)

Timeline for d7juea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d7juea2