SCOPe 2.07: Domain d7jufb_: 7juf B:

Lineage for d7jufb_ (7juf B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.0: automated matches [191331] (1 protein)
   not a true family

6. Protein automated matches [190159] (20 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186882] (106 PDB entries)

8. Domain d7jufb_: 7juf B: [399005]
   automated match to d3alta_
   complexed with ca, peg

Details for d7jufb_

PDB Entry: 7juf, 1.4 Å

PDB Description: c-type carbohydrate-recognition domain 4 of the mannose receptor complexed with man-alpha1-2man

PDB Compounds: (B:) Macrophage mannose receptor 1

SCOPe Domain Sequences for d7jufb_:

Sequence, based on SEQRES records:

>d7jufb_ d.169.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cpedwgassrtslcfklyakgkhekktwfesrdfcralggdlasinnkeeqqtiwrlita
sgsyhklfwlgltygspsegftwsdgspvsyenwaygepnnyqnveycgelkgdptmswn
dincehlnnwicqi

Sequence, based on observed residues (ATOM records):

>d7jufb_ d.169.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cpedwgasslcfklyakgkhekktwfesrdfcralggdlasinnkeeqqtiwrlitasgs
yhklfwlgltygspsegftwsdgspvsyenwaygepnnyqnveycgelkgdptmswndin
cehlnnwicqi

Timeline for d7jufb_:

• d7jufb_ is new in SCOPe 2.07-stable
  
• d7jufb_ appears in the current release, SCOPe 2.08