Lineage for d7jufb_ (7juf B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3001353Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 3001354Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 3002276Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 3002277Protein automated matches [190159] (21 species)
    not a true protein
  7. 3002332Species Human (Homo sapiens) [TaxId:9606] [186882] (109 PDB entries)
  8. 3002351Domain d7jufb_: 7juf B: [399005]
    automated match to d3alta_
    complexed with ca, peg

Details for d7jufb_

PDB Entry: 7juf (more details), 1.4 Å

PDB Description: c-type carbohydrate-recognition domain 4 of the mannose receptor complexed with man-alpha1-2man
PDB Compounds: (B:) Macrophage mannose receptor 1

SCOPe Domain Sequences for d7jufb_:

Sequence, based on SEQRES records: (download)

>d7jufb_ d.169.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cpedwgassrtslcfklyakgkhekktwfesrdfcralggdlasinnkeeqqtiwrlita
sgsyhklfwlgltygspsegftwsdgspvsyenwaygepnnyqnveycgelkgdptmswn
dincehlnnwicqi

Sequence, based on observed residues (ATOM records): (download)

>d7jufb_ d.169.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cpedwgasslcfklyakgkhekktwfesrdfcralggdlasinnkeeqqtiwrlitasgs
yhklfwlgltygspsegftwsdgspvsyenwaygepnnyqnveycgelkgdptmswndin
cehlnnwicqi

SCOPe Domain Coordinates for d7jufb_:

Click to download the PDB-style file with coordinates for d7jufb_.
(The format of our PDB-style files is described here.)

Timeline for d7jufb_: