SCOPe 2.08: Domain d7jufa_: 7juf A:

Lineage for d7jufa_ (7juf A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.0: automated matches [191331] (1 protein)
   not a true family

6. Protein automated matches [190159] (21 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186882] (109 PDB entries)

8. Domain d7jufa_: 7juf A: [399000]
   automated match to d3alta_
   complexed with ca, peg

Details for d7jufa_

PDB Entry: 7juf, 1.4 Å

PDB Description: c-type carbohydrate-recognition domain 4 of the mannose receptor complexed with man-alpha1-2man

PDB Compounds: (A:) Macrophage mannose receptor 1

SCOPe Domain Sequences for d7jufa_:

Sequence; same for both SEQRES and ATOM records:

>d7jufa_ d.169.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtslcfklyakgkhekktwfesrdfcralggdlasinnkeeqqtiwrlitasgsyhklfw
lgltygspsegftwsdgspvsyenwaygepnnyqnveycgelkgdptmswndincehlnn
wicqi

Timeline for d7jufa_:

• d7jufa_ first appeared in SCOPe 2.07