SCOPe 2.05: Domain d3dbvr2: 3dbv R:149-312

Lineage for d3dbvr2 (3dbv R:149-312)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
   core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1

4. Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families)
   N-terminal domain is the classic Rossmann-fold

5. Family d.81.1.1: GAPDH-like [55348] (6 proteins)
   has many additional secondary structures

6. Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (19 species)

7. Species Bacillus stearothermophilus, nca 1503 [TaxId:1422] [55351] (11 PDB entries)

8. Domain d3dbvr2: 3dbv R:149-312 [39900]
   Other proteins in same PDB: d3dbvo1, d3dbvp1, d3dbvq1, d3dbvr1
   complexed with nad, so4; mutant

Details for d3dbvr2

PDB Entry: 3dbv, 2.45 Å

PDB Description: glyceraldehyde-3-phosphate dehydrogenase mutant with leu 33 replaced by thr, thr 34 replaced by gly, asp 36 replaced by gly, leu 187 replaced by ala, and pro 188 replaced by ser complexed with nad+

PDB Compounds: (R:) glyceraldehyde-3-phosphate dehydrogenase

SCOPe Domain Sequences for d3dbvr2:

Sequence; same for both SEQRES and ATOM records:

>d3dbvr2 d.81.1.1 (R:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]}
cttnclapfakvlheqfgivrgmmttvhsytndqrildashkdlrraraaaesiiptttg
aakavalvlpelkgklngmamrvptpnvsvvdlvaelekevtveevnaalkaaaegelkg
ilayseeplvsrdyngstvsstidalstmvidgkmvkvvswyd

Timeline for d3dbvr2:

• d3dbvr2 first appeared (with stable ids) in SCOP 1.55
  
• d3dbvr2 appears in SCOPe 2.04
  
• d3dbvr2 appears in SCOPe 2.06
  
• d3dbvr2 appears in the current release, SCOPe 2.08