Lineage for d3dbvr2 (3dbv R:149-312)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 259192Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 259193Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 259194Family d.81.1.1: GAPDH-like [55348] (2 proteins)
    has many additional secondary structures
  6. 259205Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (13 species)
  7. 259214Species Bacillus stearothermophilus, nca 1503 [TaxId:1422] [55351] (6 PDB entries)
  8. 259238Domain d3dbvr2: 3dbv R:149-312 [39900]
    Other proteins in same PDB: d3dbvo1, d3dbvp1, d3dbvq1, d3dbvr1
    complexed with nad, so4; mutant

Details for d3dbvr2

PDB Entry: 3dbv (more details), 2.45 Å

PDB Description: glyceraldehyde-3-phosphate dehydrogenase mutant with leu 33 replaced by thr, thr 34 replaced by gly, asp 36 replaced by gly, leu 187 replaced by ala, and pro 188 replaced by ser complexed with nad+

SCOP Domain Sequences for d3dbvr2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dbvr2 d.81.1.1 (R:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503}
cttnclapfakvlheqfgivrgmmttvhsytndqrildashkdlrraraaaesiiptttg
aakavalvlpelkgklngmamrvptpnvsvvdlvaelekevtveevnaalkaaaegelkg
ilayseeplvsrdyngstvsstidalstmvidgkmvkvvswyd

SCOP Domain Coordinates for d3dbvr2:

Click to download the PDB-style file with coordinates for d3dbvr2.
(The format of our PDB-style files is described here.)

Timeline for d3dbvr2: