Lineage for d7jmkb1 (7jmk B:1-245)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2585054Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2585055Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2585297Family d.142.1.4: Succinyl-CoA synthetase, beta-chain, N-terminal domain [56081] (1 protein)
    automatically mapped to Pfam PF13549
    automatically mapped to Pfam PF08442
  6. 2585298Protein Succinyl-CoA synthetase, beta-chain, N-terminal domain [56082] (3 species)
  7. 2585326Species Pig (Sus scrofa) [TaxId:9823] [56084] (13 PDB entries)
    GTP-specific enzyme
  8. 2585333Domain d7jmkb1: 7jmk B:1-245 [398993]
    Other proteins in same PDB: d7jmka1, d7jmka2, d7jmkb2, d7jmkc1, d7jmkc2, d7jmkd2
    automated match to d2nu8b2
    complexed with gdp, mg

Details for d7jmkb1

PDB Entry: 7jmk (more details), 2.5 Å

PDB Description: gtp-specific succinyl-coa synthetase complexed with mg-gdp in space group p32
PDB Compounds: (B:) Succinate--CoA ligase [GDP-forming] subunit beta, mitochondrial

SCOPe Domain Sequences for d7jmkb1:

Sequence, based on SEQRES records: (download)

>d7jmkb1 d.142.1.4 (B:1-245) Succinyl-CoA synthetase, beta-chain, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
mnlqeyqskklmsdngvkvqrffvadtanealeaakrlnakeivlkaqilaggrgkgvfs
sglkggvhltkdpevvgqlakqmigynlatkqtpkegvkvnkvmvaealdisretylail
mdrscngpvlvgspqggvdieevaasnpelifkeqidiiegikdsqaqrmaenlgflgpl
qnqaadqikklynlflkidatqvevnpfgetpegqvvcfdakinfddnaefrqkdifamd
dksen

Sequence, based on observed residues (ATOM records): (download)

>d7jmkb1 d.142.1.4 (B:1-245) Succinyl-CoA synthetase, beta-chain, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
mnlqeyqskklmsdngvkvqrffvadtanelnakeivlkaqilaggrglkggvhltkdpe
vvgqlakqmigynlatkqtpkegvkvnkvmvaealdisretylailmdrscngpvlvgsp
qggvdieevaasnpelifkeqidiiegikdsqaqrmaenlgflgplqnqaadqikklynl
flkidatqvevnpfgetpegqvvcfdakinfddnaefrqkdifamddksen

SCOPe Domain Coordinates for d7jmkb1:

Click to download the PDB-style file with coordinates for d7jmkb1.
(The format of our PDB-style files is described here.)

Timeline for d7jmkb1: