Lineage for d3dbvq2 (3dbv Q:149-312)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 866361Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 866362Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 866363Family d.81.1.1: GAPDH-like [55348] (6 proteins)
    has many additional secondary structures
  6. 866417Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (19 species)
  7. 866441Species Bacillus stearothermophilus, nca 1503 [TaxId:1422] [55351] (11 PDB entries)
  8. 866484Domain d3dbvq2: 3dbv Q:149-312 [39899]
    Other proteins in same PDB: d3dbvo1, d3dbvp1, d3dbvq1, d3dbvr1

Details for d3dbvq2

PDB Entry: 3dbv (more details), 2.45 Å

PDB Description: glyceraldehyde-3-phosphate dehydrogenase mutant with leu 33 replaced by thr, thr 34 replaced by gly, asp 36 replaced by gly, leu 187 replaced by ala, and pro 188 replaced by ser complexed with nad+
PDB Compounds: (Q:) glyceraldehyde-3-phosphate dehydrogenase

SCOP Domain Sequences for d3dbvq2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dbvq2 d.81.1.1 (Q:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]}
cttnclapfakvlheqfgivrgmmttvhsytndqrildashkdlrraraaaesiiptttg
aakavalvlpelkgklngmamrvptpnvsvvdlvaelekevtveevnaalkaaaegelkg
ilayseeplvsrdyngstvsstidalstmvidgkmvkvvswyd

SCOP Domain Coordinates for d3dbvq2:

Click to download the PDB-style file with coordinates for d3dbvq2.
(The format of our PDB-style files is described here.)

Timeline for d3dbvq2: