SCOP 1.73: Domain d3dbvq2: 3dbv Q:149-312

Lineage for d3dbvq2 (3dbv Q:149-312)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.81: FwdE/GAPDH domain-like [55346] (3 superfamilies)
   core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1

4. Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families)
   N-terminal domain is the classic Rossmann-fold

5. Family d.81.1.1: GAPDH-like [55348] (6 proteins)
   has many additional secondary structures

6. Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (19 species)

7. Species Bacillus stearothermophilus, nca 1503 [TaxId:1422] [55351] (10 PDB entries)

8. Domain d3dbvq2: 3dbv Q:149-312 [39899]
   Other proteins in same PDB: d3dbvo1, d3dbvp1, d3dbvq1, d3dbvr1

Details for d3dbvq2

PDB Entry: 3dbv, 2.45 Å

PDB Description: glyceraldehyde-3-phosphate dehydrogenase mutant with leu 33 replaced by thr, thr 34 replaced by gly, asp 36 replaced by gly, leu 187 replaced by ala, and pro 188 replaced by ser complexed with nad+

PDB Compounds: (Q:) glyceraldehyde-3-phosphate dehydrogenase

SCOP Domain Sequences for d3dbvq2:

Sequence; same for both SEQRES and ATOM records:

>d3dbvq2 d.81.1.1 (Q:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]}
cttnclapfakvlheqfgivrgmmttvhsytndqrildashkdlrraraaaesiiptttg
aakavalvlpelkgklngmamrvptpnvsvvdlvaelekevtveevnaalkaaaegelkg
ilayseeplvsrdyngstvsstidalstmvidgkmvkvvswyd

Timeline for d3dbvq2:

• d3dbvq2 first appeared (with stable ids) in SCOP 1.55
  
• d3dbvq2 appears in SCOP 1.71
  
• d3dbvq2 appears in SCOP 1.75
  
• d3dbvq2 appears in the current release, SCOPe 2.08