Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (2 families) |
Family c.23.4.1: Succinyl-CoA synthetase domains [52211] (3 proteins) contain additional N-terminal strand "0", antiparallel to strand 2 |
Protein Succinyl-CoA synthetase, alpha-chain, C-terminal domain [52212] (6 species) |
Species Pig (Sus scrofa) [TaxId:9823] [52214] (13 PDB entries) |
Domain d7jj0c2: 7jj0 C:131-306 [398989] Other proteins in same PDB: d7jj0a1, d7jj0b1, d7jj0b2, d7jj0c1, d7jj0d1, d7jj0d2 automated match to d1euda2 complexed with gcp, mg |
PDB Entry: 7jj0 (more details), 2.25 Å
SCOPe Domain Sequences for d7jj0c2:
Sequence, based on SEQRES records: (download)
>d7jj0c2 c.23.4.1 (C:131-306) Succinyl-CoA synthetase, alpha-chain, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} ncpgvinpgeckigimpghihkkgrigivsrsgtltyeavhqttqvglgqslcvgiggdp fngtdftdcleiflndpategiiligeiggnaeenaaeflkqhnsgpkskpvvsfiaglt appgrrmghagaiiaggkggakekitalqsagvvvsmspaqlgttiykefekrkml
>d7jj0c2 c.23.4.1 (C:131-306) Succinyl-CoA synthetase, alpha-chain, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} ncpgvinpgeckigimpghihkkgrigivsrsgtltyeavhqttqvglgqslcvgiggdp fngtdftdcleiflndpategiiligeiggnaeenaaeflkqhnsgpkskpvvsfiaglt appghagaiiggakekitalqsagvvvsmspaqlgttiykefekrkml
Timeline for d7jj0c2: