SCOPe 2.07: Domain d7jj0c2: 7jj0 C:131-306

Lineage for d7jj0c2 (7jj0 C:131-306)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (2 families)

5. Family c.23.4.1: Succinyl-CoA synthetase domains [52211] (3 proteins)
   contain additional N-terminal strand "0", antiparallel to strand 2

6. Protein Succinyl-CoA synthetase, alpha-chain, C-terminal domain [52212] (6 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [52214] (13 PDB entries)

8. Domain d7jj0c2: 7jj0 C:131-306 [398989]
   Other proteins in same PDB: d7jj0a1, d7jj0b1, d7jj0b2, d7jj0c1, d7jj0d1, d7jj0d2
   automated match to d1euda2
   complexed with gcp, mg

Details for d7jj0c2

PDB Entry: 7jj0, 2.25 Å

PDB Description: gtp-specific succinyl-coa synthetase complexed with mg-gmppcp

PDB Compounds: (C:) Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial

SCOPe Domain Sequences for d7jj0c2:

Sequence, based on SEQRES records:

>d7jj0c2 c.23.4.1 (C:131-306) Succinyl-CoA synthetase, alpha-chain, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
ncpgvinpgeckigimpghihkkgrigivsrsgtltyeavhqttqvglgqslcvgiggdp
fngtdftdcleiflndpategiiligeiggnaeenaaeflkqhnsgpkskpvvsfiaglt
appgrrmghagaiiaggkggakekitalqsagvvvsmspaqlgttiykefekrkml

Sequence, based on observed residues (ATOM records):

>d7jj0c2 c.23.4.1 (C:131-306) Succinyl-CoA synthetase, alpha-chain, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
ncpgvinpgeckigimpghihkkgrigivsrsgtltyeavhqttqvglgqslcvgiggdp
fngtdftdcleiflndpategiiligeiggnaeenaaeflkqhnsgpkskpvvsfiaglt
appghagaiiggakekitalqsagvvvsmspaqlgttiykefekrkml

Timeline for d7jj0c2:

• d7jj0c2 is new in SCOPe 2.07-stable
  
• d7jj0c2 appears in the current release, SCOPe 2.08