SCOPe 2.07: Domain d7jj0d2: 7jj0 D:246-393

Lineage for d7jj0d2 (7jj0 D:246-393)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (2 families)

5. Family c.23.4.1: Succinyl-CoA synthetase domains [52211] (3 proteins)
   contain additional N-terminal strand "0", antiparallel to strand 2

6. Protein Succinyl-CoA synthetase, beta-chain, C-terminal domain [52215] (3 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [52217] (13 PDB entries)

8. Domain d7jj0d2: 7jj0 D:246-393 [398978]
   Other proteins in same PDB: d7jj0a1, d7jj0a2, d7jj0b1, d7jj0c1, d7jj0c2, d7jj0d1
   automated match to d2nu8e1
   complexed with gcp, mg

Details for d7jj0d2

PDB Entry: 7jj0, 2.25 Å

PDB Description: gtp-specific succinyl-coa synthetase complexed with mg-gmppcp

PDB Compounds: (D:) Succinate--CoA ligase [GDP-forming] subunit beta, mitochondrial

SCOPe Domain Sequences for d7jj0d2:

Sequence; same for both SEQRES and ATOM records:

>d7jj0d2 c.23.4.1 (D:246-393) Succinyl-CoA synthetase, beta-chain, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
epieneaakydlkyigldgniacfvngaglamatcdiiflnggkpanfldlgggvkesqv
yqafklltadpkveailvnifggivncaiiangitkacrelelkvplvvrlegtnvheaq
niltnsglpitsavdledaakkavasvt

Timeline for d7jj0d2:

• d7jj0d2 is new in SCOPe 2.07-stable
  
• d7jj0d2 appears in the current release, SCOPe 2.08