Lineage for d7dsab_ (7dsa B:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3020312Fold e.43: Subunits of heterodimeric actin filament capping protein Capz [90095] (1 superfamily)
    3 domains: (1) protozoan pheromone-like alpha-helical bundle; (2) rubredoxin-like domain lacking metal-binding site; (3) alpha+beta heterodimerisation domain: alpha-beta(5)-alpha
  4. 3020313Superfamily e.43.1: Subunits of heterodimeric actin filament capping protein Capz [90096] (3 families) (S)
  5. 3020330Family e.43.1.2: Capz beta-1 subunit [90100] (2 proteins)
    automatically mapped to Pfam PF01115
  6. 3020331Protein Capz beta-1 subunit [90101] (1 species)
  7. 3020332Species Chicken (Gallus gallus) [TaxId:9031] [90102] (8 PDB entries)
  8. 3020338Domain d7dsab_: 7dsa B: [398960]
    Other proteins in same PDB: d7dsaa_, d7dsac_
    automated match to d3aa7b_
    complexed with mg

Details for d7dsab_

PDB Entry: 7dsa (more details), 2.8 Å

PDB Description: crystal structure of actin capping protein in complex with v-1 (space group p62)
PDB Compounds: (B:) F-actin-capping protein subunit beta isoforms 1

SCOPe Domain Sequences for d7dsab_:

Sequence, based on SEQRES records: (download)

>d7dsab_ e.43.1.2 (B:) Capz beta-1 subunit {Chicken (Gallus gallus) [TaxId: 9031]}
sdqqldcaldlmrrlppqqieknlsdlidlvpslcedllssvdqplkiardkvvgkdyll
cdynrdgdsyrspwsnkydppledgampsarlrkleveannafdqyrdlyfeggvssvyl
wdldhgfagvilikkagdgskkikgcwdsihvvevqekssgrtahykltstvmlwlqtnk
tgsgtmnlggsltrqmekdetvsdssphianigrlvedmenkirstlneiyfgktkdivn
glr

Sequence, based on observed residues (ATOM records): (download)

>d7dsab_ e.43.1.2 (B:) Capz beta-1 subunit {Chicken (Gallus gallus) [TaxId: 9031]}
sdqqldcaldlmrrlppqqieknlsdlidlvpslcedllssvdqplkiardkgkdyllcd
ynrdgdsyrspwsnkydpplgampsarlrkleveannafdqyrdlyfeggvssvylwdld
hgfagvilikkagdgskkikgcwdsihvvevqekssgrtahykltstvmlwlqtnktgsg
tmnlggsltrqmekdetvsdssphianigrlvedmenkirstlneiyfgktkdivnglr

SCOPe Domain Coordinates for d7dsab_:

Click to download the PDB-style file with coordinates for d7dsab_.
(The format of our PDB-style files is described here.)

Timeline for d7dsab_: