SCOPe 2.07: Domain d7duob_: 7duo B:

Lineage for d7duob_ (7duo B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.14: N-(deoxy)ribosyltransferase-like [52309] (4 families)
   there are similar active site architectures as well as the catalytic mechanisms of functionally characterised members

5. Family c.23.14.3: ADP ribosyl cyclase-like [56630] (3 proteins)
   contains extra N-terminal all-alpha subdomain
   automatically mapped to Pfam PF02267

6. Protein ADP ribosyl cyclase [56631] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [159490] (45 PDB entries)
   Uniprot P28907 45-291

8. Domain d7duob_: 7duo B: [398958]
   Other proteins in same PDB: d7duol1, d7duol2
   automated match to d5f1kb_

Details for d7duob_

PDB Entry: 7duo, 2.81 Å

PDB Description: crystal structure of daratumumab fab and cd38 complex

PDB Compounds: (B:) ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1

SCOPe Domain Sequences for d7duob_:

Sequence; same for both SEQRES and ATOM records:

>d7duob_ c.23.14.3 (B:) ADP ribosyl cyclase {Human (Homo sapiens) [TaxId: 9606]}
krfpetvlarcvkyteihpemrhvdcqsvwdafkgafiskhpcniteedyqplmklgtqt
vpcnkillwsrikdlahqftqvqrdmftledtllgyladdltwcgefntskinyqscpdw
rkdcsnnpvsvfwktvsrrfaeaacdvvhvmlngsrskifdknstfgsvevhnlqpekvq
tleawvihggredsrdlcqdptikelesiiskrniqfsckniyrpdkfl

Timeline for d7duob_:

• d7duob_ is new in SCOPe 2.07-stable
  
• d7duob_ appears in the current release, SCOPe 2.08